로그인  |   회원가입  |   ID/PW 찾기  
Home > 전제품보기 > 항체 · ELISA · Signal > 항체 > Polyclonal Anti-Rat Bone Specific Alkaline Phosphatase

Polyclonal Anti-Rat Bone Specific Alkaline Phosphatase


제조사 제품코드 제품명 용량 가격
비고 사용자매뉴얼
Anti-Rat Bone Specific Alkaline Phosphatase, Polyclonal
관련학술 관심상품등록 구매하기
0.1 mg
676,000원  M190_DS.v1902.pdf

polyclonal 항체 (동결 건조 제품) 0.1 mg
실온 수송, 항체 복원 후 (2.0 ㎎ / ㎖) 필요에 따라 분주하여 -20 ℃에서 1 년 또는 4 ℃에서 보관할 경우 방부제를 첨가하고 6 개월 이내에 사용
파라핀 포매 절편의 면역 조직 염색 (10 ~ 20 ㎍/㎖), western blotting ( 2 ~ 5 ㎍/㎖)
마우스 항원에 반응
인간 항원에 매우 약한 반응
human 과 rat Bone Specific Alkaline Phosphatase의 homology가 높은 부분의 펩타이드 (20-49) [PEKEKDPKYWRDQAQETLKYALELQKLNTN] 와 KLH 복합체를 항원으로 한 토끼 polyclonal antibody.
특이성 :
Rat Bone Specific Alkaline Phosphatase에 반응한다.
동결 건조 제품 (멸균수 50 ㎕에 용해한다. (2.0 mg/㎖, 방부제를 포함하지 않음) 이것을 stock solution으로 하고, 희석이 필요한 경우는 다음의 희석액을 이용한다.

* 희석액
10 mM PBS (pH7.4)
1.0 % bovine serum albumin
0.1 % sodium azide

Keyword :
> 항체 교차 반응 일람표
> 항체 용도 일람표
> Anti-Albumin
> Anti-Bovine Osteocalcin
> Anti-Bromodeoxyuridine
> Anti-CD3 mAb GMP grade
> Anti-Chicken N-cadherin
> Anti-Heme Oxygenase-1
> Anti-Human Ago2 (Argonaute 2)
> Anti-Human Calpastatin
> Anti-Human E-cadherin
> Anti-Human Fibronectin
> Anti-Human Influenza Virus
> Anti-Human Insulin
> Anti-Human iPS
> Anti-Human Laminin
> Anti-Human N-cadherin
> Anti-Human Osteocalcin
> Anti-Human P-cadherin
> Anti-Human Platelet GMP-140 (P-selectin/CD62)
> Anti-Human Platelet GP Ib (CD42b)
> Anti-Human Procollagen Type I C-peptide (PIP)
> Anti-Human Vitronectin
> Anti-Human von Willebrand Factor (vWF)
> Anti-Insulin C
> Anti-Mouse E-cadherin
> Anti-Mouse Osteocalcin
> Anti-Mouse P-cadherin
> Anti-Osteonectin/SPARC
> Anti-ProS2
> Anti-Rat Collagen type II
> Anti-Rat Osteocalcin
> Monoclonal 2nd antibody 시리즈
> Polyclonal Anti-Dentin Matrix Protein1
> Polyclonal Anti-Glucagon
> Polyclonal Anti-Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
파골 세포 Cystein Protease, CathepsinK의 검출
> Polyclonal Anti-Human Cathepsin K
> Polyclonal Anti-Human Influenza A, B
> Polyclonal Anti-Human Insulin C
> Polyclonal Anti-Mouse Osteocalcin
> Polyclonal Anti-N-cadherin
> Polyclonal Anti-Rat Bone Specific Alkaline Phosphatase
> Polyclonal Anti-Tartrate-resistant Acid Phosphatase (TRACP)
> Procalcitonin EIA Kit